PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025151P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 296aa    MW: 33855.9 Da    PI: 8.8455
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025151P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.75.3e-082468345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +WT+eE + +  a + + ++   +W ++a++++ g+t  +++  + 
   MELO3C025151P1 24 KWTKEENKMFESALAIYDKEtpdRWFKVAAMIP-GKTVSDVIKQYK 68
                     8*****************99*************.*****9998876 PP

2Myb_DNA-binding43.86e-14125169347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+++++++  ++G+g+W+ I+r + + +t+ q+ s+ qky
   MELO3C025151P1 125 PWTEEEHKQFLRGLLKYGKGDWRNISRNFVNSKTPTQVASHAQKY 169
                      8*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.6422074IPR017884SANT domain
SMARTSM007177.1E-102173IPR001005SANT/Myb domain
SuperFamilySSF466895.74E-122377IPR009057Homeodomain-like
CDDcd001675.00E-82470No hitNo description
PfamPF002498.4E-72469IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-12116175IPR009057Homeodomain-like
PROSITE profilePS5129419.365118174IPR017930Myb domain
SuperFamilySSF466892.01E-16120173IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-17121173IPR006447Myb domain, plants
SMARTSM007177.1E-12122172IPR001005SANT/Myb domain
CDDcd001677.07E-10125170No hitNo description
PfamPF002491.9E-11125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
METLYPSSHL SSSAWFVLDN PSTKWTKEEN KMFESALAIY DKETPDRWFK VAAMIPGKTV  60
SDVIKQYKEL EEDVCEIEAG RFPIPGYDLA SSFSFEFVDD RNFDVYRRKS SVGRGSDHER  120
KKGVPWTEEE HKQFLRGLLK YGKGDWRNIS RNFVNSKTPT QVASHAQKYF MRQLSGGKDK  180
RRPSIHDITT VNLTEPTASE NEKLSSMDQF SKLPSLQKSP CYQKLLFDWN RSNNGGFLGL  240
GSNYGDRLVS FPSGIAANGI KNEQDHELNS AYYGTYSKPH KSIFQFEPSR YQIYG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-1625871173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00489DAPTransfer from AT5G05790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ8703040.0AJ870304.1 Cucumis sativus mRNA for somatic embryogenesis MYB 1 transcription factor (SEM1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463216.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H76e-94DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLQ5NDD20.0Q5NDD2_CUCSA; Somatic embryogenesis MYB 1 transcription factor
STRINGVIT_13s0019g03370.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.12e-90MYB family protein